PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00004046001
Common NameGSBRNA2T00004046001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 367aa    MW: 40884.8 Da    PI: 8.4914
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00004046001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.19.8e-24207251145
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                          k+r+rWtpeLHe+Fveav++LGGse+AtPk +l++mkv+gLt++h
  GSBRNA2T00004046001 207 KTRMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVDGLTIYH 251
                          68*****************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-20206251IPR009057Homeodomain-like
SuperFamilySSF466891.45E-9206251IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-15207250IPR006447Myb domain, plants
PfamPF143795.8E-11278313IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MEARPVQRSC SMEIINLART TLIPSNPSTG EESFIRSENN NTHLMSRPSV QQTYRLLSSS  60
NNGAVGHICS STSSGFSTNL HYSSTVSHEK HGSSSNDTSW CHDSLHGGRF LDLPEASHVD  120
DGGIGSAFDD IQKRNDWHEW ADHLITDEDP LLSTNWSDLL LDTSSHSDSK VQIPPQAHQT  180
VQQQPSPSVE LRPVSTTSSN SNSGTGKTRM RWTPELHEAF VEAVNSLGGS ERATPKGVLK  240
IMKVDGLTIY HKMVDTLEKK LTPLEHIASL DLKGGIGITE ALRLQMELKL QRNLQLRIEE  300
QGKYLQMMFE KQNSGLEKRQ LQNQIPQSNP TKKTRKQMIK RSSYQRKQGI AKSLNLLRQS  360
VPKPDN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3107991e-103AJ310799.1 Arabidopsis thaliana mRNA for phosphate starvation response regulator 1 (phr1 gene).
GenBankJN0098021e-103JN009802.1 UNVERIFIED: Lupinus polyphyllus phosphate starvation response regulator-like mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593488.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_013593489.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_013593490.10.0PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN53e-50PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078IP440.0A0A078IP44_BRANA; BnaA03g58920D protein
STRINGBra024188.1-P1e-158(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-134phosphate starvation response 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]